PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_21525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 132aa    MW: 15418.7 Da    PI: 10.7228
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_21525genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35.3e-111370461
                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                 k+ +r+ +NRe+ArrsR RK+  +  L   v +L +eN++   +++  ++ +a++++
  PEQU_21525 13 EKKRKRMLSNRESARRSRIRKQNHLNDLVSQVGNLREENSQILAQVKLRSEWSARVEA 70
                5999************************************998888776666666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-121081IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.2891259IPR004827Basic-leucine zipper domain
PfamPF077165.1E-101260IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-101260No hitNo description
SuperFamilySSF579594.13E-111462No hitNo description
CDDcd147023.89E-131563No hitNo description
PROSITE patternPS0003601732IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MSTEEERRLD FDEKKRKRML SNRESARRSR IRKQNHLNDL VSQVGNLREE NSQILAQVKL  60
RSEWSARVEA ENSVMRAQVM ELTERLRSMN SLLGFLEASS SMVMEIPDPL LKPWQLPCPA  120
QSIMASTTVF RR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12633RRSRIRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010914566.15e-53PREDICTED: LOW QUALITY PROTEIN: ocs element-binding factor 1-like
SwissprotQ9LZP86e-36BZP53_ARATH; bZIP transcription factor 53
TrEMBLW1P3A92e-47W1P3A9_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr11P05140_0013e-42(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.13e-37basic region/leucine zipper motif 53