PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_21260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family TCP
Protein Properties Length: 275aa    MW: 30443.7 Da    PI: 11.4017
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_21260genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP59.41.4e-18125162744
         TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkd 44 
                 +++++hTkv+gR+RRvRl+  caar+F+L++eLG+++d
  PEQU_21260 125 SSKDRHTKVNGRGRRVRLPPICAARIFQLTRELGHKSD 162
                 689**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.2E-15125162IPR005333Transcription factor, TCP
PROSITE profilePS5136911.129126180IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MNMIRASATH LDRFSKICRP VKIIIQYPET LDFLFFPVPE FLSPYHKYST SPLLLSLHKT  60
LAMPGPTSLT LMPSPPSPSP PSPPASDLLI YNPTAVHSSG AITAEPLQMR SEMADVRGKK  120
REGGSSKDRH TKVNGRGRRV RLPPICAARI FQLTRELGHK SDRVAAAAGG TLYPCSHRQW  180
NQPAPFRHHC HLISGTMSSF PASTAGAAHR LLSVQWNYGL RCRSEGLWFL RDVRRRUGFG  240
GGIPAYAVLH SNADASGERR RUGQPRRHRA TSGGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020582531.11e-101LOW QUALITY PROTEIN: transcription factor PCF1-like
TrEMBLA0A1D6ZNH01e-100A0A1D6ZNH0_PHAEQ; TCP transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47620.16e-18TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14