PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_20967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family YABBY
Protein Properties Length: 132aa    MW: 14605.1 Da    PI: 8.5733
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_20967genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY61.53.6e-19262262
       YABBY  2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaesh 62
                d  s s+++Cyv+C++C+t+lav vP + +  +vtv+CGhC sl  +n +   q+l + ++
  PEQU_20967  2 DFGSPSDHLCYVRCAYCTTVLAVGVPCKRMTDTVTVKCGHCNSLSFLNPKPPFQTLCSDHQ 62
                566889*************************************998888777777766554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.1E-19663IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MDFGSPSDHL CYVRCAYCTT VLAVGVPCKR MTDTVTVKCG HCNSLSFLNP KPPFQTLCSD  60
HQQTLLQVRI SPLPTSLYNV INWAKCDPRA LFYSATTASG ARRPATTAIQ LVYKIIEITN  120
LLASYLISLL LF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020583837.12e-44protein DROOPING LEAF-like
TrEMBLA0A1W5ZNL42e-40A0A1W5ZNL4_9ASPA; Drooping leaf
TrEMBLA0A2I0XDQ42e-40A0A2I0XDQ4_9ASPA; Protein DROOPING LEAF
STRINGVIT_01s0011g00140.t015e-26(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59513657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.13e-20YABBY family protein