PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_20629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family VOZ
Protein Properties Length: 620aa    MW: 69793.7 Da    PI: 6.9453
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_20629genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ419.74.7e-1293425581217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdls 99 
                 ppp+afl+ kcalwdc+rp+qgsew+qdycssfhatla+negl+g+ pvlrp+gidlkdg+lfa+l ak+qgk+vgip+cegaat kspwna+elfdls
  PEQU_20629 342 PPPAAFLRQKCALWDCPRPTQGSEWCQDYCSSFHATLAFNEGLLGMIPVLRPGGIDLKDGPLFASLAAKAQGKDVGIPQCEGAATIKSPWNAPELFDLS 440
                 89************************************************************************************************* PP

         VOZ 100 llegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakg 198
                 +lege++rewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqps++fewhl+eyei+++d +alyrle+kl+d+kks+++
  PEQU_20629 441 VLEGESLREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMEEFGGLKRSYYMDPQPSNHFEWHLFEYEISNSDVCALYRLEFKLTDHKKSSRA 539
                 *************************************************************************************************** PP

         VOZ 199 kvskdsladlqkklgrlta 217
                 k + d l+dlq+++g+l+a
  PEQU_20629 540 KPNVDLLVDLQQQMGKLSA 558
                 *****************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGKDCRSASH QMFKDKAKNR VDDLQGMFSD LQSARRESRV GDVAVLEEQV NLMLREWKAE  60
LNEASPANSL LGYSRVSSDL SSEIRRLLQL GEEEDDATSK FAELPPTNLK PEPVDTPEAF  120
VGSGQGARSA AFQEVDFSAH FSSFSCFHSL KSVLAEVVLF PLQEVSPFHL TNTSFTLPTP  180
RRTPSIYNSS KITSKLYVSV GSSVGTPHKE RKQQPNKNMH KESKPSVFPL LESPFSLSKL  240
SFLAYSPNSS NFSSLHRRLL HISVMLLNYH VHQELLQNEF VTANQYRVNL TIDTADAVSN  300
CQVASAVDYP QFNLNQDMQN NQYIDAVTLL PHFQEMLPMI CPPPAAFLRQ KCALWDCPRP  360
TQGSEWCQDY CSSFHATLAF NEGLLGMIPV LRPGGIDLKD GPLFASLAAK AQGKDVGIPQ  420
CEGAATIKSP WNAPELFDLS VLEGESLREW LFFDKPRRAF ESGNRKQRSL PDYSGRGWHE  480
SRKQVMEEFG GLKRSYYMDP QPSNHFEWHL FEYEISNSDV CALYRLEFKL TDHKKSSRAK  540
PNVDLLVDLQ QQMGKLSAKN CSDKKRHGKG RAKANHDNTE CAQNELIPTI NGSPIYGPHL  600
PYAYSMEGFN HDNYYGSNLK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020574331.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-127VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM0SP170.0M0SP17_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P15020_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-130vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]