PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_20117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CO-like
Protein Properties Length: 262aa    MW: 29606.4 Da    PI: 4.8688
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_20117genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.84.4e-08142641
    zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                C+ +++ + +l+C+++  +lC +C +++H+       H +vp
  PEQU_20117  1 CDSCHSLPPSLYCRSDAAYLCINCDSTIHSAnslarrHHRVP 42
                ******99*********************6688999977776 PP

2CCT70.25.3e-24195238144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRY+eK+ktRkF+K irY+sRKa+Ae+RpR+KGrFvk++
  PEQU_20117 195 REARVLRYREKKKTRKFQKVIRYASRKAYAETRPRIKGRFVKRT 238
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.7E-6143IPR000315B-box-type zinc finger
PfamPF006439.1E-6143IPR000315B-box-type zinc finger
CDDcd000219.36E-10143No hitNo description
PROSITE profilePS5011911.405143IPR000315B-box-type zinc finger
PROSITE profilePS5101716.36195237IPR010402CCT domain
PfamPF062031.0E-17195237IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
CDSCHSLPPS LYCRSDAAYL CINCDSTIHS ANSLARRHHR VPLLPIPSGG LIAGGISVAQ  60
PKEDEEEEEK EEEEEEEKVG FFLGGEVDEY FDLVEFSTCC EEEGREKYEG REEEDKRMLQ  120
SFQMGYEGIN KGIDCSSSIG HTVSFLILFE FPLVLKITFP NSATVVFHTG LSSIEATVVA  180
EDTIQIPQQL SSMDREARVL RYREKKKTRK FQKVIRYASR KAYAETRPRI KGRFVKRTDA  240
ELEVDQMFAA SHVMVEAGFG VV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ8104230.0FJ810423.1 Phalaenopsis amabilis CONSTANS-like 1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLF2Q6J91e-148F2Q6J9_PHAAB; CONSTANS-like 1 (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.15e-44CONSTANS-like 2