PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_19549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GeBP
Protein Properties Length: 268aa    MW: 29376.4 Da    PI: 10.8198
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_19549genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573575.6e-188733297
      DUF573 32 ddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                 d++ fy+ +++s+s  +++sql+eK+rrL+kK++++  ++++g++ps  ++hd++ ++ls ++W+
  PEQU_19549  8 RDLNIFYDRFSESMSQPYTRSQLSEKLRRLRKKYRTMAGRIARGQDPSRLSQHDRDLLHLSTRLWD 73
                699**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.7E-17873IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
AQGLVFPRDL NIFYDRFSES MSQPYTRSQL SEKLRRLRKK YRTMAGRIAR GQDPSRLSQH  60
DRDLLHLSTR LWDPSNASTS PFSAPDAVAA GSAGNKRRRP NPRAPTSRAR ASSSPHQVIV  120
ALESALLPPP NPPLALPSTS PVAYKKECMD PLPSIGHNGS IDGANFAASP EEIPKNKLPT  180
PPISSSVDPK RSGAKHLAIK SVLDVLDVAL NEVRSTLANQ GIISSNGTSE QGLEMKGMSK  240
RWQAHRLAEL DLLAQRWRLV VEEKATQI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.21e-09DNA-binding storekeeper protein-related transcriptional regulator