PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_19000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CPP
Protein Properties Length: 135aa    MW: 14890.2 Da    PI: 8.623
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_19000genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.32.3e-16847342
         TCR  3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                +k+C+Ck+skClk+YC+Cfaag +C+++C C++C+N++e+
  PEQU_19000  8 QKRCSCKRSKCLKLYCDCFAAGMFCNKSCACQGCSNNSEN 47
                79**********************************9985 PP

2TCR54.32.7e-1792130139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkkskClkkYCeC++ag+ Cs  C+Ce+CkN 
  PEQU_19000  92 RHKRGCNCKKSKCLKKYCECYQAGVGCSLGCRCEGCKNV 130
                 589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.5E-15647IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.2847132IPR005172CRC domain
PfamPF036387.1E-13844IPR005172CRC domain
SMARTSM011144.5E-1792133IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-1394129IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
KNPEIEGQKR CSCKRSKCLK LYCDCFAAGM FCNKSCACQG CSNNSENEEM VSSTRQLIEA  60
RNPLAFAPKV VHANGDLKES ADNKHITPPS ARHKRGCNCK KSKCLKKYCE CYQAGVGCSL  120
GCRCEGCKNV YGMKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-20813011121Protein lin-54 homolog
5fd3_B2e-20813011121Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020590388.13e-91uncharacterized protein LOC110031506 isoform X1
SwissprotF4JIF56e-52TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A2I0WBE32e-83A0A2I0WBE3_9ASPA; Protein tesmin/TSO1-like CXC 2
STRINGXP_008785101.12e-58(Phoenix dactylifera)
STRINGXP_008792142.12e-59(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-41TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]