PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_18999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CPP
Protein Properties Length: 211aa    MW: 23525.4 Da    PI: 8.7971
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_18999genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25.1e-1674113342
         TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                 +k+C+Ck+skClk+YC+Cfaag +C+++C C++C+N++e+
  PEQU_18999  74 QKRCSCKRSKCLKLYCDCFAAGMFCNKSCACQGCSNNSEN 113
                 79**********************************9985 PP

2TCR53.25.8e-17158196139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkkskClkkYCeC++ag+ Cs  C+Ce+CkN 
  PEQU_18999 158 RHKRGCNCKKSKCLKKYCECYQAGVGCSLGCRCEGCKNV 196
                 589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.5E-1572113IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.28473198IPR005172CRC domain
PfamPF036381.5E-1274110IPR005172CRC domain
SMARTSM011144.5E-17158199IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12160195IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MQPEFSVHHI TPCSRKGLPG VETSKSEDSA QTSLGKKRQA CILLTLFYCL PFSLFFLFLL  60
FRFNRKKNPE IEGQKRCSCK RSKCLKLYCD CFAAGMFCNK SCACQGCSNN SENEEMVSST  120
RQLIEARNPL AFAPKVVHAN GDLKESADNK HITPPSARHK RGCNCKKSKC LKKYCECYQA  180
GVGCSLGCRC EGCKNVYGMK EGMLETSLVL P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-197419611121Protein lin-54 homolog
5fd3_B2e-197419611121Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020590388.11e-123uncharacterized protein LOC110031506 isoform X1
SwissprotQ9LUI35e-53TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A2I0WBE31e-100A0A2I0WBE3_9ASPA; Protein tesmin/TSO1-like CXC 2
STRINGGSMUA_Achr2P17070_0013e-62(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-42TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]