PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_18754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GATA
Protein Properties Length: 183aa    MW: 20637 Da    PI: 10.866
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_18754genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.6e-185992134
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                Cs C ttkTplWR+gp g+k+LCnaCG+++ k +
  PEQU_18754 59 CSDCSTTKTPLWRSGPLGPKSLCNACGIKQMKAR 92
                ****************************987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577169.03E-145299No hitNo description
SMARTSM004011.5E-1553106IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-145791IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.9915786IPR000679Zinc finger, GATA-type
CDDcd002021.09E-1158103No hitNo description
PfamPF003201.3E-155992IPR000679Zinc finger, GATA-type
PROSITE patternPS0034405984IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MSSKMRIMRK FVCSEQKTVR RIRRRRRRCQ QIQDDQRKEG NKDQSSCESS NNGGINRVCS  60
DCSTTKTPLW RSGPLGPKSL CNACGIKQMK ARKAMSSAAQ SSKLQYPVVP IKPEKNQSSK  120
VDCSIPFKKR CRFVATAEAA QRKLSFEDMP VALKERLVAL KGVFPQDEKD AAILLMALAH  180
RDS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11926RRIRRRRR
21927RRIRRRRRR
32027RIRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020585085.11e-132putative GATA transcription factor 22
TrEMBLA0A2I0X3972e-86A0A2I0X397_9ASPA; GATA transcription factor 22
STRINGXP_008780491.14e-37(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18933899
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26150.13e-26cytokinin-responsive gata factor 1