PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_18376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family Dof
Protein Properties Length: 258aa    MW: 27987.6 Da    PI: 9.4176
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_18376genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.41.3e-371977260
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                kekal+cprC+stntkfCyynnys sqPr+fCk+CrryWt+GG+lrnvP+Ggg+rk+k+
  PEQU_18376 19 KEKALNCPRCNSTNTKFCYYNNYSFSQPRFFCKSCRRYWTQGGTLRNVPIGGGSRKKKR 77
                57899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-271577IPR003851Zinc finger, Dof-type
PfamPF027011.9E-332177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5092377IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102561IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
METAQWHQQG LERKVRPYKE KALNCPRCNS TNTKFCYYNN YSFSQPRFFC KSCRRYWTQG  60
GTLRNVPIGG GSRKKKRFNP SSSLPPPAAT KSAPIVSSTS MNLQPSKLIP HELSSFSLFS  120
SSSSMSATRS GISFEGSSLS KENELSANAR KRLRMLAPSS MSLYCQELHA LGLQKQGGFG  180
MEELMWSGVK LPLQYGVGGM KESKEAGGDG EHALPFEDLN QVTVKGSCDE IVGGVDPSLF  240
WEGVMGNDGG GGGGGGGW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020582215.10.0dof zinc finger protein DOF4.6-like, partial
TrEMBLA0A2I0WMP94e-85A0A2I0WMP9_9ASPA; Dof zinc finger protein DOF4.6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.19e-37Dof family protein