PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_18252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 392aa    MW: 42922.7 Da    PI: 7.5211
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_18252genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.23.5e-2867123259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 dDgynWrKYGqK+vk+++ +rsYYrCt  +C +kkkver+  +++v+e++Y+g+Hnhe
  PEQU_18252  67 DDGYNWRKYGQKQVKSTDRSRSYYRCTNGDCFAKKKVERCP-NGQVTEVIYRGQHNHE 123
                 8****************************************.***************8 PP

2WRKY102.62.2e-32237294259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK vkg+++prsYYrCt+ gC+v+k+ve+s++d k ++itYeg+Hnh+
  PEQU_18252 237 SDGYRWRKYGQKIVKGNPNPRSYYRCTHDGCRVRKHVEKSSDDAKSIVITYEGKHNHD 294
                 8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-2556125IPR003657WRKY domain
PROSITE profilePS5081120.6961125IPR003657WRKY domain
SuperFamilySSF1182901.7E-2362125IPR003657WRKY domain
SMARTSM007741.4E-2866124IPR003657WRKY domain
PfamPF031066.8E-2267123IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-32225296IPR003657WRKY domain
PROSITE profilePS5081134.785231296IPR003657WRKY domain
SuperFamilySSF1182901.57E-27231296IPR003657WRKY domain
SMARTSM007741.4E-36236295IPR003657WRKY domain
PfamPF031061.1E-25238294IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MSHQAVLATV TAQAQMQLQA GYPSPSGSLK NSSPQSMLLP LASETEKTSS FEQKSQSSLI  60
VPKTTTDDGY NWRKYGQKQV KSTDRSRSYY RCTNGDCFAK KKVERCPNGQ VTEVIYRGQH  120
NHEQPHRAKL SKLKGLPSSG AIGVTEGLDV PGVEPAEADP STSKVDQNSS NGNPEQQLFC  180
SSDCEGDGSI RAEEDPHEEQ EPEPKRRQVY ATDPTPVFRT VKQPKIVMQT AAAGHVSDGY  240
RWRKYGQKIV KGNPNPRSYY RCTHDGCRVR KHVEKSSDDA KSIVITYEGK HNHDVPTLQS  300
PIDPPVTTTL FIDSASSATP AETLDQSESM VDKKLSINSP PEIKKGSELG SEKGSESAQA  360
LLSMSCDPES GEEGMKSKLF TEKTATVPVR NS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-27227296877Probable WRKY transcription factor 4
2lex_A1e-27227296877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020581217.10.0LOW QUALITY PROTEIN: probable WRKY transcription factor 4
SwissprotQ9XI902e-75WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A1S6YG450.0A0A1S6YG45_PHAEQ; WRKY DNA-binding protein
STRINGXP_008776488.11e-142(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.12e-66WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]