PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_18052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 331aa    MW: 37223.1 Da    PI: 6.2498
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_18052genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.21.1e-30122178258
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                 dDgy+WrKYGqK +k+s+++rsYYrCt ++C++kk+ve+s+edp++v +tYeg H h
  PEQU_18052 122 DDGYKWRKYGQKLIKNSPNTRSYYRCTNPRCNAKKQVEKSTEDPNTVMVTYEGLHLH 178
                 8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-28116179IPR003657WRKY domain
PROSITE profilePS5081125.97116181IPR003657WRKY domain
SuperFamilySSF1182901.83E-25119179IPR003657WRKY domain
SMARTSM007748.9E-35121180IPR003657WRKY domain
PfamPF031065.6E-24122178IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEDKLDESEV NWLESMEEEL IKQDVLFETE LVPLMAPLTP TEPQSELPKE ELVNLLVSKV  60
YSGPTIGDVE SALSLSCSSK KLGNGGGGNQ HRSGLAEKGW SSTKMENKYI LRIRTCVDGV  120
ADDGYKWRKY GQKLIKNSPN TRSYYRCTNP RCNAKKQVEK STEDPNTVMV TYEGLHLHYT  180
YSHILLSQKH DKHAANLNAV KKPKIQESEG QQHRQPMAHL PQSPQKREQT QQKKILTAEE  240
SRQECFLKDI LLENPSLREK SVENGLLTDA QRTQGMLEDV VPLMVRKPCS SDAPLNDPCY  300
SSQESSPTHD TSLLLSPSSS LIDIGILSSI W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-191221781874Probable WRKY transcription factor 4
2lex_A1e-191221781874Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020580742.10.0probable WRKY transcription factor 49 isoform X2
TrEMBLA0A2P1JMM41e-150A0A2P1JMM4_9ASPA; WRKY transcription factor 49-like
STRINGXP_008777314.13e-85(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75253551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-35WRKY DNA-binding protein 49