PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_17923
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family DBB
Protein Properties Length: 161aa    MW: 18004.6 Da    PI: 7.0188
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_17923genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.16.4e-07445540
    zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 C+ ++ + ++  C  ++  lC+ C +  H+       H++v
  PEQU_17923  4 QCDVCGVETASVLCYADEAALCRRCDEGVHSAnklagkHRRV 45
                7*****999*********************667888888766 PP

2zf-B_box25.52.7e-085587335
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                 + C+ ++ek+   fC+d +  lC+dC +++H 
  PEQU_17923 55 LPLCDICKEKKGFVFCQDERAILCKDCDFQIHA 87
                579*****************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.627147IPR000315B-box-type zinc finger
SMARTSM003361.5E-11147IPR000315B-box-type zinc finger
PfamPF006434.5E-6445IPR000315B-box-type zinc finger
CDDcd000219.18E-7547No hitNo description
SMARTSM003363.6E-853100IPR000315B-box-type zinc finger
PROSITE profilePS501198.6315395IPR000315B-box-type zinc finger
PfamPF006431.7E-55587IPR000315B-box-type zinc finger
CDDcd000211.05E-65687No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MKLQCDVCGV ETASVLCYAD EAALCRRCDE GVHSANKLAG KHRRVFLLPH PLRTLPLCDI  60
CKEKKGFVFC QDERAILCKD CDFQIHATNT NTSKHMRFLF SGIRLSTTPI PSAFSSTTEN  120
DNSCRSTISD YLMNMLPGWR VDDFLFDDVA STGNFSGCHL V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009385243.12e-53PREDICTED: probable salt tolerance-like protein At1g75540
SwissprotQ9LQZ73e-43BBX21_ARATH; B-box zinc finger protein 21
TrEMBLM0RUA86e-54M0RUA8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P21780_0012e-53(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23923679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.12e-44salt tolerance homolog2