PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_16914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 103aa    MW: 12039.4 Da    PI: 9.3596
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_16914genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.57.5e-302078159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                ldDgy+WrKYG+K+vk+s++ r+YYrC++ gC vkk+ver++edp+++++tYeg Hnh+
  PEQU_16914 20 LDDGYKWRKYGKKSVKNSRNLRNYYRCSTDGCLVKKRVERDHEDPSYLVTTYEGIHNHT 78
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-30780IPR003657WRKY domain
SuperFamilySSF1182904.32E-271380IPR003657WRKY domain
PROSITE profilePS5081127.7951580IPR003657WRKY domain
SMARTSM007747.6E-332079IPR003657WRKY domain
PfamPF031061.4E-232177IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
PRMEEGSRIA FRIQTDVENL DDGYKWRKYG KKSVKNSRNL RNYYRCSTDG CLVKKRVERD  60
HEDPSYLVTT YEGIHNHTSP GIVYYAKQDS VSGRFHLSGS WSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-23780174WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020591476.18e-74probable WRKY transcription factor 51 isoform X1
RefseqXP_020591477.18e-74probable WRKY transcription factor 51 isoform X2
SwissprotQ93WU97e-34WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLA0A2I0VXJ61e-60A0A2I0VXJ6_9ASPA; Putative WRKY transcription factor 51
STRINGXP_008810071.11e-50(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.13e-36WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Yan C, et al.
    Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis.
    Mol. Cell, 2018. 70(1): p. 136-149.e7
    [PMID:29625034]