PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_14742
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 263aa    MW: 28631.1 Da    PI: 6.1187
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_14742genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.33.9e-0988133651
                 HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                 + +r   NReA r++R++Kka+ + Le++v +L + N++L k+l+ 
  PEQU_14742  88 NKKRSFGNREAVRKYREKKKARAASLEDEVVQLREINQQLMKKLQG 133
                 5788899**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-682150IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1285151No hitNo description
PROSITE profilePS502178.58885132IPR004827Basic-leucine zipper domain
PfamPF077164.5E-1388140IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.06E-790133No hitNo description
CDDcd146861.70E-1295142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MDDPDLDFSN PEVFSGPNAG EELPSSCSMD SFFDEILKDT QHHSCTHTHT CNPPGPDLSH  60
THTCFHVHTK ILSAPTDETA ESAEKGSNKK RSFGNREAVR KYREKKKARA ASLEDEVVQL  120
REINQQLMKK LQGQAALEAE VARLRCLLVD IRGRIEGEIG SFPYLKPMKV GGDSISQMPQ  180
PNYMNGAHAQ NPCDFRCDDQ AYCFLPAMQG KNGVEASLMH QAHGSCEIGN IQCMGSSTTG  240
SKEILGCGGG NVINAGGSSK MDN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010935120.11e-134PREDICTED: uncharacterized protein LOC105055101
SwissprotQ8VY762e-88BZP19_ARATH; Basic leucine zipper 19
TrEMBLM0RZZ11e-127M0RZZ1_MUSAM; Uncharacterized protein
TrEMBLM0SAN51e-126M0SAN5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P14830_0011e-126(Musa acuminata)
STRINGGSMUA_Achr3P00670_0011e-126(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.18e-67bZIP family protein