PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_14737
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 162aa    MW: 17647 Da    PI: 10.6339
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_14737genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.74e-1692144557
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                 +r ++++kNRe+A rsR+RKka+++eLe +v+ L  eN aL+ e e+lk  ++
  PEQU_14737  92 RRWKKMIKNRESAARSRARKKAYTDELEMEVAHLARENAALRREQEKLKMAID 144
                 5779********************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1488152IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.39290140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.5E-1791142No hitNo description
CDDcd147073.51E-2292146No hitNo description
SuperFamilySSF579591.5E-1192140No hitNo description
PfamPF001701.3E-1392143IPR004827Basic-leucine zipper domain
PROSITE patternPS00036095110IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MDEVWKDIAF SNLPPNLSSP PLSLRHTAAA AAFHDFLAGD FGDNRRPHSP DPLPAPTLSI  60
PSGNHTNAFL PPARCAISHP SAPAIAGGGG ERRWKKMIKN RESAARSRAR KKAYTDELEM  120
EVAHLARENA ALRREQEKLK MAIDAQATTT KGKLLRASSS TF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-14bZIP family protein