PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_14392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 312aa    MW: 34343.7 Da    PI: 6.6352
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_14392genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.74e-3851149199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkC++dC+lap fpae++ +f n+h+lFG+sn+lk+lk+++e++r++am+s+++++++ra+dP  G++++il+lq+q+e + ++l+++ +
  PEQU_14392  51 ACAACKYQRRKCSPDCTLAPFFPAEKHLQFINAHRLFGVSNILKILKSVDESHRQEAMNSIIFQSNIRAQDPSGGCYRIILNLQRQIEATYTQLQHVLN 149
                 7****************************************************************************************9999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.71650151IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3651146IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MKPPLPPISI PPPNYAKKQR NRAHPNPPIS SPHSPSPKLN MGPLTSPSSS ACAACKYQRR  60
KCSPDCTLAP FFPAEKHLQF INAHRLFGVS NILKILKSVD ESHRQEAMNS IIFQSNIRAQ  120
DPSGGCYRII LNLQRQIEAT YTQLQHVLNQ VAFLRSQFNP AADGAADIDA IYGLQQPQQH  180
CNNFCFAYDV PKDLQGAHEH GINGHDNVNP IDIGNEELRQ QVLFGIQGKE GREEGVDVRS  240
LADMYGMQHG FGICKEQEDA AQNISIGSTI TGLCSSMAEA KADANIIDEV QEHDLRSAAS  300
FFSLNNCDTQ AI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-23421442104LOB family transfactor Ramosa2.1
5ly0_B7e-23421442104LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020577312.10.0LOB domain-containing protein 35-like
TrEMBLA0A2I0WKW95e-72A0A2I0WKW9_9ASPA; LOB domain-containing protein 22
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-41LOB domain-containing protein 22