PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_14366
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 132aa    MW: 15377.2 Da    PI: 9.679
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_14366genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY993e-312785159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                +dDg++WrKYG+K vk+s++pr+YYrC+s+gC vkk+ver+++dp++v+++Yeg+Hnh+
  PEQU_14366 27 MDDGFKWRKYGKKAVKSSPNPRNYYRCSSSGCGVKKRVERDRNDPSYVITIYEGTHNHK 85
                69********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.2E-331487IPR003657WRKY domain
SuperFamilySSF1182902.75E-281987IPR003657WRKY domain
PROSITE profilePS5081131.1582287IPR003657WRKY domain
SMARTSM007742.9E-332786IPR003657WRKY domain
PfamPF031062.8E-252885IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
AEEVKRRKIE AAEYRIGFRT KSDVEIMDDG FKWRKYGKKA VKSSPNPRNY YRCSSSGCGV  60
KKRVERDRND PSYVITIYEG THNHKSPDES RHPYMSYEVP HSSSPWSSCA QIIPNLTPNF  120
TWNTQFAPFS YT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-271787777Probable WRKY transcription factor 4
2lex_A6e-271787777Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020577278.12e-95probable WRKY transcription factor 50
SwissprotQ8VWQ53e-36WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A2I0B6D71e-48A0A2I0B6D7_9ASPA; Putative WRKY transcription factor 50
STRINGGSMUA_Achr7P09680_0019e-43(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-38WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]