PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_13748
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family Dof
Protein Properties Length: 258aa    MW: 28274.3 Da    PI: 8.7858
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_13748genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1275.6e-4045105262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +e++l+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+ss
  PEQU_13748  45 PEQSLRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGSLRNVPVGGGCRKNKRSS 105
                 78999*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-283699IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3347103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60949103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEISNGHHQV MATHQHDHEV LKLPKPSSSP THHLHQQEKK SRPQPEQSLR CPRCDSTNTK  60
FCYYNNYSLS QPRYFCKSCR RYWTKGGSLR NVPVGGGCRK NKRSSPSSST SSKKLGLQHH  120
QDINHSSLLI SSMPLPPPLN YDPSDLTLAF SSFHNHDTFL LGTPNSNPNP NPNASTGVGL  180
HSFYYGFSGG ADDVRGMLPF DSTAVAAETV MVGNFDPASN VNSTSTSHGS LGMESGRDYW  240
SGVGSNSSWH GLINSSLL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:30626969}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:30626969}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020571739.10.0dof zinc finger protein DOF3.1-like
SwissprotQ84TE96e-41DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A2I0X8M41e-114A0A2I0X8M4_9ASPA; Dof zinc finger protein DOF5.3
STRINGXP_008789033.16e-69(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-38TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]