PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_13623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 238aa    MW: 26129.3 Da    PI: 7.5329
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_13623genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.6e-4271061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkCa++C++apyfp e+++kf nvh++FGasn+ kll++l++++reda++sl yeAear++dPvyG+vg i+ lq++l ql+ +l+++k+
  PEQU_13623   7 PCAACKFLRRKCAQGCIFAPYFPPENQSKFSNVHRVFGASNIAKLLADLSPDQREDAVNSLSYEAEARINDPVYGCVGYISLLQHRLVQLQRDLSAAKR 105
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  PEQU_13623 106 E 106
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9936107IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSSSSSPCAA CKFLRRKCAQ GCIFAPYFPP ENQSKFSNVH RVFGASNIAK LLADLSPDQR  60
EDAVNSLSYE AEARINDPVY GCVGYISLLQ HRLVQLQRDL SAAKRELSNY INHAAVGGPN  120
NQFYATPPSM YRDQNQQMQR MEAEQFAEVI AAATEHEMLR NIEQQHVMAR FMGVGNVVDS  180
SSCQPLELVS PHIGGFQGSL AVLQQKHGGQ VQEGSGAQVR HVRRSFDDGR NGVGPSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4941108114LOB family transfactor Ramosa2.1
5ly0_B1e-4941108114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020579153.11e-177LOB domain-containing protein 25-like
RefseqXP_020579154.11e-177LOB domain-containing protein 25-like
TrEMBLA0A2I0WZA42e-88A0A2I0WZA4_9ASPA; LOB domain-containing protein 6
STRINGGSMUA_Achr6P04670_0016e-60(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-55ASYMMETRIC LEAVES 2-like 1