PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_11792
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 163aa    MW: 18093.6 Da    PI: 9.4038
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_11792genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.24.2e-366101297
      DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                 CaaCk++rrkC+++C+lap fpa++p+ f n+h+lFG s+++k+l++l+ + r++a++s++++++ara+dP  G+++++l+lq  ++  +a l+++
  PEQU_11792   6 CAACKYQRRKCSPNCILAPFFPADKPQIFLNTHRLFGLSKIIKILNSLEANARPEAIRSIIFQSNARAQDPAGGCYRIVLQLQDSIQLYRARLDHV 101
                 ***************************************************************************************999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.7814105IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-346100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
XSPPTCAACK YQRRKCSPNC ILAPFFPADK PQIFLNTHRL FGLSKIIKIL NSLEANARPE  60
AIRSIIFQSN ARAQDPAGGC YRIVLQLQDS IQLYRARLDH VLRRISAIRE RAQILQAETS  120
GSCDQDLEQC LNSGAIARQP GEVYNGGSEV RGVPIQGDVK LRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-2569912105LOB family transfactor Ramosa2.1
5ly0_B4e-2569912105LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020583717.11e-115LOB domain-containing protein 22-like
SwissprotQ9LRW18e-35LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A199VQR84e-37A0A199VQR8_ANACO; LOB domain-containing protein 22
TrEMBLA0A2C9UXW91e-37A0A2C9UXW9_MANES; Uncharacterized protein
TrEMBLA0A2H3X8163e-37A0A2H3X816_PHODC; LOB domain-containing protein 7-like
STRINGcassava4.1_022118m2e-38(Manihot esculenta)
STRINGXP_008779803.14e-38(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-37LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]