PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_11287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GRF
Protein Properties Length: 201aa    MW: 22461.2 Da    PI: 9.6828
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_11287genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.7e-2582124244
         WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  PEQU_11287  82 LEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 124
                 69**************************************997 PP

2QLQ62.11.5e-211045237
         QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                +FTa+Q+q+L++Q+l++Ky+a++ P+P++L+++i++
  PEQU_11287 10 PFTASQWQELEHQALIFKYMASGIPIPSDLILPIRR 45
                9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-11945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.2951045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.9E-161044IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.79181125IPR014977WRC domain
PfamPF088791.0E-2083124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGGRSSSRYP FTASQWQELE HQALIFKYMA SGIPIPSDLI LPIRRSFLLD STTTSPSLVF  60
PPQTQLGWSC FQMGFGKKAE DLEPGRCRRT DGKKWRCSKE AYPDSKYCER HMHRGKNRSR  120
KPVEISLAAK TNHSSSSSSS SSSAQSPYLA NLSISTPETN YHLSCPFSNS SRPPWAHLSS  180
DSGASHLQLN SDQNVFLISH F
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020582469.11e-137growth-regulating factor 1-like isoform X2
SwissprotQ6AWY86e-73GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2I0W1J71e-105A0A2I0W1J7_9ASPA; Growth-regulating factor 1
STRINGXP_008786732.12e-75(Phoenix dactylifera)
STRINGOPUNC02G31900.14e-74(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-53growth-regulating factor 5