PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_10616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 154aa    MW: 17056.6 Da    PI: 8.213
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_10616genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.99.4e-4026124199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C lapyfp ++p kf  +h++FGasn++k l++lpe++r da+ss+vyeA +r++dPvyG++g i  lq+q+e+l+a+la+ ++
  PEQU_10616  26 PCAACKILRRRCAAQCLLAPYFPPTEPLKFTTAHHVFGASNIIKSLQELPESQRADAVSSMVYEATVRIKDPVYGCAGAICYLQKQVEELQAQLARSRA 124
                 7*********************************************************************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.90525126IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-4026122IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
STTSSSFSPP LPPHQNPAPR SNYQSPCAAC KILRRRCAAQ CLLAPYFPPT EPLKFTTAHH  60
VFGASNIIKS LQELPESQRA DAVSSMVYEA TVRIKDPVYG CAGAICYLQK QVEELQAQLA  120
RSRAPRAELL AVETQHNHIL ALFCKDFDFC LPQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-392511910104LOB family transfactor Ramosa2.1
5ly0_B3e-392511910104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020578233.11e-109LOB domain-containing protein 1-like
SwissprotQ9LQR03e-55LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK084e-55LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A2I0VRM68e-76A0A2I0VRM6_9ASPA; LOB domain-containing protein 11
STRINGXP_008789049.11e-61(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-57LOB domain-containing protein 1