PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_10386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 323aa    MW: 36046.2 Da    PI: 7.6661
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_10386genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_119.91.6e-061852331159
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                  + R + +rsR RK+++i  L++ v++Le+   +L+ ++ +l ++  +l
  PEQU_10386 185 TSRRRSGQRSRVRKLQYISDLQKTVEALETMGAELATQVATLFQQRIAL 233
                 5558899***********************9999999888887776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.6E-4179239IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-5188231No hitNo description
Gene3DG3DSA:1.20.5.1707.4E-8188231No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MSRHSNLPPR CPLQNKCLRT RSLDPSDLIA QGDDQCSPEL FRHQSMDFLL EENTSWLDDL  60
LTDSDSSPQG RCHRRSASDS LTISHGYDSL RTPTHTATLS SVSVNEAEDA ARSMDGGGLE  120
ANCVYGPNSP RQMSKLTNSE SAIVNALLDK VPRNRLQYAE SSGGSRIHEP GHGEAPSAEP  180
ELERTSRRRS GQRSRVRKLQ YISDLQKTVE ALETMGAELA TQVATLFQQR IALSLENKYI  240
RQQISILLHE KIIKDGEHRC LKNEAEKLKM ISGRHRRSKS ISSPYLEPGQ HENVHSGTSW  300
QSLDFRKLSL GESSVPFNHG LGH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1187193RRSGQRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008799706.18e-90PREDICTED: uncharacterized protein At4g06598
RefseqXP_008799707.18e-90PREDICTED: uncharacterized protein At4g06598
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-13bZIP family protein