PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_09833
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 440aa    MW: 48454.3 Da    PI: 5.4729
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_09833genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY68.41.1e-212032461458
                 --TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
        WRKY  14 evkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                 +vkgse+prsYY+Ct+++C++kkkvers  +++++ei+Y+g+Hnh
  PEQU_09833 203 QVKGSEYPRSYYKCTHPNCEAKKKVERSL-NGQITEIIYKGRHNH 246
                 8****************************.*************** PP

2WRKY105.13.7e-33366423259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d + v++tYeg+Hnhe
  PEQU_09833 366 EDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCTVRKHVERASHDLNSVITTYEGKHNHE 423
                 8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031063.6E-15201246IPR003657WRKY domain
SuperFamilySSF1182901.83E-14201246IPR003657WRKY domain
SMARTSM007746.7E-16203248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-15203246IPR003657WRKY domain
PROSITE profilePS5081113.505204246IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-36350425IPR003657WRKY domain
SuperFamilySSF1182901.96E-28357425IPR003657WRKY domain
PROSITE profilePS5081136.564360425IPR003657WRKY domain
SMARTSM007744.0E-38365424IPR003657WRKY domain
PfamPF031064.5E-25366423IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MAGMEDNVPV IGDWPSPNIS PRTFFSDFIA KQCSSRFISD DSEQKTDGSL PESGEPDENQ  60
DCEPGQLSKE HLTEMNSSNA SNSSIRGGLS ERIAARAGFR NLFLDTSQIR KTTRLPFTTK  120
DHRSPLLTIP PGISPTMLLS SPICASNSVT EPFPTTGKMD FMECDNITAA VINGNTNHTT  180
EDVDPASFSL KQPLLYLSCA ETQVKGSEYP RSYYKCTHPN CEAKKKVERS LNGQITEIIY  240
KGRHNHFKSS TIHRSSFSSS PSGNDFQIDD LEQNECSQDE FNANQNGFIP VEQCERSNPS  300
SLLSNDDEDE QVTHGSGSIS GDGDGDETES KRRKLDACAL EMSAASRAGR EPRVVFQTTS  360
AIDILEDGYR WRKYGQKVVK GNPNPRSYYK CTNPGCTVRK HVERASHDLN SVITTYEGKH  420
NHELPIGRTG NPSSSPASSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-33357425977Probable WRKY transcription factor 4
2lex_A6e-33357425977Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020579325.11e-158probable WRKY transcription factor 2
SwissprotO655903e-90WRK34_ARATH; Probable WRKY transcription factor 34
TrEMBLA0A251U8Z11e-111A0A251U8Z1_HELAN; Putative WRKY domain-containing protein
STRINGGSMUA_Achr5P04150_0011e-100(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.12e-86WRKY DNA-binding protein 34
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Hu X, et al.
    Proteasome-mediated degradation of FRIGIDA modulates flowering time in Arabidopsis during vernalization.
    Plant Cell, 2014. 26(12): p. 4763-81
    [PMID:25538183]
  3. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]