PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_08965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CPP
Protein Properties Length: 768aa    MW: 83748.4 Da    PI: 6.1841
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_08965genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.54.1e-16486523340
         TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 +++CnCkkskClk+YCeCfaag++C e C+C++C Nk 
  PEQU_08965 486 CRRCNCKKSKCLKLYCECFAAGVYCVEPCSCQGCLNKP 523
                 789*********************************96 PP

2TCR50.25.2e-16570608139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  PEQU_08965 570 RHKRGCNCKKSSCLKKYCECYQGGVGCSFSCRCEGCKNA 608
                 589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-16484525IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.705485610IPR005172CRC domain
PfamPF036389.3E-12487522IPR005172CRC domain
SMARTSM011144.5E-16570611IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.0E-11572608IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MDTPERSKIG GTPISKFEDS PVFNFINSLS PIQPVKSVHS IHTFHSPGSA ALSSVFSSPH  60
VSLHKESRFL IRHPFPDSVK QEVSSNSLDE NNLHSLVPND AILSTSIVLA QENCNITCSL  120
NEASVDLVDE SSSQPDFSPS AQVDNGSPNH NTLPFYGVKL DFKQDISCSP SERVKFVQAA  180
SESTQNSYAN NFGYEVKFPA VQMKEDASGS DWENLISDNT DDLFIFEPAT GSEPSNSEEK  240
DNKISLNLQP NASCLQNDPQ VSFTDDDDGE TRQGHGVSHM LNLFSTTCHE PENSDDLNQK  300
TEAELCDGLT LGCKADSKHH RGVRRRCLVF EAASASKKSM NSNSNVRPSI LLPINAMSDS  360
DNRQLVPSKS SEAPVPYVLP GIGLHLNALA TTSKDGSIPQ IIRTPGREFI SRRCSVKPFA  420
PSNSLEKQQF KLSKLHQCPD LIGSEVQDSQ TVHSDVSLIP ALGIEESTSP KKRRRKTESN  480
GENEGCRRCN CKKSKCLKLY CECFAAGVYC VEPCSCQGCL NKPVHEETVL ATRKQIESRN  540
PLAFAPKVIR TSEHDQEIGE ESNKTPASAR HKRGCNCKKS SCLKKYCECY QGGVGCSFSC  600
RCEGCKNAFG RKEGFEEIEY EEELDPCEKE SVKSDDGKAN ANVPKIEHPN LTESSLPATP  660
FPACSGKPPR SSTLSQMSRS ESQQAECKSV QLFPDDDTSE DLRVNSSPCA AVKTVSPNGK  720
RVSLPLNGFG MSPNLKGGRK LILKSIPSFP SLSTDAPTAA QFNSSVLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1748960714120Protein lin-54 homolog
5fd3_B3e-1748960714120Protein lin-54 homolog
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1470475KKRRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020579697.10.0protein tesmin/TSO1-like CXC 3 isoform X2
TrEMBLA0A2I0WLZ60.0A0A2I0WLZ6_9ASPA; Protein tesmin/TSO1-like CXC 2
STRINGXP_008789994.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-119TESMIN/TSO1-like CXC 2