PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_07128
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family M-type_MADS
Protein Properties Length: 151aa    MW: 17369.2 Da    PI: 10.4327
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_07128genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF689.2e-221052244
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                + e++s r+ t++kRr+gilKKA+ELS+LCd+ev++++fs++g
  PEQU_07128 10 KLESNSARNATYTKRRAGILKKAKELSILCDIEVLLLMFSPNG 52
                67999************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-24160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.38152IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-23281IPR002100Transcription factor, MADS-box
CDDcd001201.51E-22254No hitNo description
PRINTSPR004044.5E-16323IPR002100Transcription factor, MADS-box
PfamPF003197.6E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MGRAKLQIKK LESNSARNAT YTKRRAGILK KAKELSILCD IEVLLLMFSP NGNPTLCLGE  60
QSNLVQMISK FYQLSPQGRE NRKTFKNLDH DELTNHLQTL KAQLAELELR LSYWTDPGKV  120
QSIDQIQRME HTLRASLNQI QIQKVRVIHS I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020575605.15e-94agamous-like MADS-box protein AGL65
RefseqXP_020575606.15e-94agamous-like MADS-box protein AGL65
RefseqXP_020575607.15e-94agamous-like MADS-box protein AGL65
RefseqXP_020575608.15e-94agamous-like MADS-box protein AGL65
TrEMBLA0A2I0B5F42e-55A0A2I0B5F4_9ASPA; MADS-box transcription factor 16
STRINGSb05g025970.12e-57(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69540.13e-44AGAMOUS-like 94