PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_06885
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 126aa    MW: 14043.1 Da    PI: 8.7499
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_06885genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.24.4e-41211191100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrrkC++dCv+apyfp +qp kf nvh++FGasnv+k+l++l++ ereda++sl+yeAe+r+rdPvyG++g+ + lq+ql++l+ +l+++++
  PEQU_06885  21 PCAGCKFLRRKCQPDCVFAPYFPPDQPTKFSNVHRVFGASNVTKILNDLKPFEREDAVNSLAYEAEMRLRDPVYGCAGI-SLLQRQLRELQIDLSRARS 118
                 7****************************************************************************95.78*************9988 PP

      DUF260 100 e 100
                 e
  PEQU_06885 119 E 119
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.24520120IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4021117IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
NVLTIPTPPT MASGGHTVSS PCAGCKFLRR KCQPDCVFAP YFPPDQPTKF SNVHRVFGAS  60
NVTKILNDLK PFEREDAVNS LAYEAEMRLR DPVYGCAGIS LLQRQLRELQ IDLSRARSEL  120
VKYQSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-5191233114LOB family transfactor Ramosa2.1
5ly0_B2e-5191233114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020702209.15e-66protein ASYMMETRIC LEAVES 2
RefseqXP_020702210.15e-66protein ASYMMETRIC LEAVES 2
RefseqXP_020702211.15e-66protein ASYMMETRIC LEAVES 2
SwissprotQ32SG36e-59LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A2I0VVY11e-64A0A2I0VVY1_9ASPA; LOB domain-containing protein 6
STRINGVIT_00s0340g00090.t013e-58(Vitis vinifera)
STRINGPavir.J03307.1.p5e-58(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.47e-56LBD family protein