PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_06547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 97aa    MW: 11325.8 Da    PI: 6.3808
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_06547genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26044.83.5e-1415745101
      DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                 +l++lp ++r +a+++++ eA++r++dPvyG+++ i  lq++++++++ela++k+++
  PEQU_06547   1 MLQQLPLHDRAQAADAIATEAHWRVQDPVYGCTERIVCLQHEISKAQNELAVMKAQI 57 
                 799*************************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.589157IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-12154IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MLQQLPLHDR AQAADAIATE AHWRVQDPVY GCTERIVCLQ HEISKAQNEL AVMKAQIAIH  60
IAHHEKQQHS EAQYYQCYLK DNDSFVPYWP NLRPDFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020571888.12e-67LOB domain-containing protein 24-like
TrEMBLA0A2I0W0U91e-28A0A2I0W0U9_9ASPA; LOB domain-containing protein 12
STRINGXP_008801576.15e-17(Phoenix dactylifera)
STRINGSb07g026800.18e-17(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2753444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-15LOB domain-containing protein 24