PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_06542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GRAS
Protein Properties Length: 351aa    MW: 39574.1 Da    PI: 5.9349
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_06542genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS379.25.1e-116133630373
        GRAS  30 laspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaL 128
                 +asp+g++++Rlaayfte+La + ++ +++++++ pp++ +e   ++e++al+l+ +++Pi+kf h+t N+ +++a+eg++rvHiiD+di+qGlQWp+L
  PEQU_06542   1 MASPTGTTVHRLAAYFTEGLAITAVKLWPHIFSINPPRDITEPIDDDEATALRLLDQATPIPKFIHFTLNERLMRAFEGKDRVHIIDLDIKQGLQWPSL 99 
                 58***************************************999******************************************************* PP

        GRAS 129 lqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdev 227
                 +q+LasRp++p ++RiTg+g+    sk e+++tg rLa +A++l++pf+f++ v+++led++l++L+vk+gE+laVn+vlqlh++l +++  +   +++
  PEQU_06542 100 FQSLASRPNPPKHVRITGIGE----SKPEIQSTGARLAGLADSLNLPFQFHA-VVDQLEDVRLWMLHVKEGECLAVNCVLQLHKMLYDDTGGSL--RDL 191
                 *********************....***************************.7********************************77655544..78* PP

        GRAS 228 LklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                 + +v+s++P +v v+e+eadhn++++  rf+++l+yy+a+fd+l+++lp++s+er k+E++ ++r+i++++a eg+e   rhe+++kW+++++++GF +
  PEQU_06542 192 MCVVRSTNPAIVLVAEEEADHNHHQLEVRFANSLNYYAAVFDALNVSLPEDSSERLKIEKM-FARKIRSIIAREGTE---RHESFSKWSRKMKDCGFDN 286
                 *************************************************************.**************9...******************* PP

        GRAS 327 vplsekaakqaklllrkvksdgyrve...eesgslvlgWkdrpLvsvSaW 373
                 v +++++  q + +lr++++  ++ve    + ++l+l W++++L++vSaW
  PEQU_06542 287 VGIGDREKIQSQVILRMYSDSNFSVErkeADGEALCLKWQEQQLYTVSAW 336
                 *******************888***96533366777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.011314IPR005202Transcription factor GRAS
PfamPF035141.8E-1131336IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MASPTGTTVH RLAAYFTEGL AITAVKLWPH IFSINPPRDI TEPIDDDEAT ALRLLDQATP  60
IPKFIHFTLN ERLMRAFEGK DRVHIIDLDI KQGLQWPSLF QSLASRPNPP KHVRITGIGE  120
SKPEIQSTGA RLAGLADSLN LPFQFHAVVD QLEDVRLWML HVKEGECLAV NCVLQLHKML  180
YDDTGGSLRD LMCVVRSTNP AIVLVAEEEA DHNHHQLEVR FANSLNYYAA VFDALNVSLP  240
EDSSERLKIE KMFARKIRSI IAREGTERHE SFSKWSRKMK DCGFDNVGIG DREKIQSQVI  300
LRMYSDSNFS VERKEADGEA LCLKWQEQQL YTVSAWAPMD VAGSSAVPQP D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-69133848380Protein SCARECROW
5b3h_A2e-69133847379Protein SCARECROW
5b3h_D2e-69133847379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020571989.10.0scarecrow-like protein 28
SwissprotQ9CAN31e-141SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A3G2CI560.0A0A3G2CI56_CYMEN; Scarecrow-like protein 28-like
STRINGXP_008800814.11e-169(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-144GRAS family protein