PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_05055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 565aa    MW: 61542 Da    PI: 6.5896
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_05055genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.45.3e-32193250260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 +DgynWrKYGqK+vkgsefprsYY+Ct+++C++kk++ers+ d+++++i+Y+g+H+h+k
  PEQU_05055 193 EDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCQMKKQLERSH-DGQITDIIYKGRHDHPK 250
                 8****************************************.***************85 PP

2WRKY106.41.5e-33368426159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++dpk+v++tYeg+Hnh+
  PEQU_05055 368 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCSVRKHVERASHDPKAVITTYEGKHNHD 426
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-27187251IPR003657WRKY domain
PROSITE profilePS5081123.365187251IPR003657WRKY domain
SuperFamilySSF1182902.88E-24191251IPR003657WRKY domain
SMARTSM007742.6E-34192250IPR003657WRKY domain
PfamPF031063.5E-24193249IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.4E-38353428IPR003657WRKY domain
SuperFamilySSF1182901.44E-29360428IPR003657WRKY domain
PROSITE profilePS5081138.607363428IPR003657WRKY domain
SMARTSM007741.5E-39368427IPR003657WRKY domain
PfamPF031064.2E-26369426IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MMSPARLPIT RSPCLTIPPG FSPGALLESP VLLTNMKAEP SPTTGSFAMP LFVNNGGLAA  60
LGSPKDSSKG CVHEDGSSPF FEFRPHIRLS SRPGLSSLAP SVSLGSNSKL QEFAGKNQSL  120
CETNGSTCSQ LVKTENITQS SAESTWSVTE ANAFPEDASN ELQQTNDSDC RIQALQSDHN  180
GAAPLNSVDK SIEDGYNWRK YGQKHVKGSE FPRSYYKCTH PNCQMKKQLE RSHDGQITDI  240
IYKGRHDHPK PQASRRLAVG GVFNGQEEEK DVFSSLANAE EMFSNAHGHG SHFNPNCNSE  300
LSPVSVSDDE VEVEGGQSGL GGDEAAAEDD PELKRRKLEV ATIDANSIAK NNREPRVVVQ  360
TVSEVDILDD GYRWRKYGQK VVKGNPNPRS YYKCTNPGCS VRKHVERASH DPKAVITTYE  420
GKHNHDVPAA KTGSSTNRES SPPLITDGNI PTSYISHQYT LPEENNAINL RLGVGVGSNP  480
TSLLSETQHL SGLERIPKNH HLQFLSSDCN NVMVQVNPAS KLYGSSNNGM FGSREDKTEG  540
FSFTTQMNNS SSHYYSRADN LVMGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-39192429878Probable WRKY transcription factor 4
2lex_A2e-39192429878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in starch synthesis (PubMed:12953112). Acts as a transcriptional activator in sugar signaling (PubMed:16167901). Interacts specifically with the SURE and W-box elements, but not with the SP8a element (PubMed:12953112). {ECO:0000269|PubMed:12953112, ECO:0000269|PubMed:16167901}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by sugar. {ECO:0000269|PubMed:12953112}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020590548.10.0WRKY transcription factor SUSIBA2-like isoform X2
SwissprotQ6VWJ61e-160WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLA0A2I0XGQ70.0A0A2I0XGQ7_9ASPA; Putative WRKY transcription factor 20
STRINGXP_008800638.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67403851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-127WRKY family protein