PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_04684
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CO-like
Protein Properties Length: 348aa    MW: 37255.9 Da    PI: 6.35
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_04684genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.8e-071765342
    zf-B_box  3 erkCpeHeeke...lqlfCedCqqllCedClleeHkg......Htvvpl 42
                +r C+ ++      ++lfC+ +  +lC +C    H+       H++v+l
  PEQU_04684 17 ARSCDACKGATvasAILFCRADAAFLCGTCDARVHSAnklasrHERVSL 65
                578*****533344*********************66889999998875 PP

2zf-B_box23.89.5e-0864107441
    zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                   C+ +e+ ++   C+ +   lC +C   +H+       H ++p
  PEQU_04684  64 SLCAVCEQAPAAVTCKADAAALCSSCDADIHSAnplasrHHRIP 107
                 68*****************************6688999966665 PP

3CCT69.77.6e-24272315144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea+++RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  PEQU_04684 272 REARVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 315
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.1E-131565IPR000315B-box-type zinc finger
PROSITE profilePS501199.7831565IPR000315B-box-type zinc finger
CDDcd000211.52E-51865No hitNo description
PfamPF006438.0E-61865IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4861108IPR000315B-box-type zinc finger
PfamPF006439.0E-664108IPR000315B-box-type zinc finger
CDDcd000217.21E-765108No hitNo description
SMARTSM003362.8E-766108IPR000315B-box-type zinc finger
PfamPF062036.7E-18272314IPR010402CCT domain
PROSITE profilePS5101716.906272314IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGFAGAESPG TFWSLRARSC DACKGATVAS AILFCRADAA FLCGTCDARV HSANKLASRH  60
ERVSLCAVCE QAPAAVTCKA DAAALCSSCD ADIHSANPLA SRHHRIPIVP FFDSPSANSS  120
AAGDGDPDPE SFFSGDAEAE ASWVLQDPPK EAQLEMPKSA NCFFSELNPF LDLEYASSVD  180
AGMYQSDSVV PAGAGIPASF MLDFAKSKPA YSGYNISPSV SFYRDCRINF ICSMSSSEFG  240
VVPDGEGCAM ADVSTCGGGR SSSVTAVSMM DREARVMRYR EKRKNRRFEK TIRYASRKAY  300
AETRPRIKGR FAKRTEMEAE FDRIYLSAAA ATAAFMAADP GFGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM4396400.0HM439640.1 Phalaenopsis hybrid cultivar CONSTANS-like 2 protein (COL2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008789696.11e-119PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X1
SwissprotQ9FHH82e-84COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLK9K3D10.0K9K3D1_9ASPA; CONSTANS-like 2 protein
STRINGGSMUA_Achr1P23420_0011e-100(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-72CONSTANS-like 5