PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_04570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 175aa    MW: 19612.3 Da    PI: 10.3161
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_04570genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.24e-141521061
                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                + +NRe+ArrsR++K+a + eLe+ v++L  eN++L k+l  +++++ +  +
  PEQU_04570  1 MLSNRESARRSRRKKQAHLSELETQVAQLRVENSSLLKRLTDINQKYNEAVM 52
                579***********************************99999999887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-10147No hitNo description
CDDcd147022.68E-18148No hitNo description
PROSITE profilePS502179.979149IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.69E-10147No hitNo description
PfamPF001702.0E-11149IPR004827Basic-leucine zipper domain
SMARTSM003383.4E-10156IPR004827Basic-leucine zipper domain
PfamPF124981.0E-1963156IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MLSNRESARR SRRKKQAHLS ELETQVAQLR VENSSLLKRL TDINQKYNEA VMENRILKTN  60
VETLRAKVKM AEDLVKRVTT AASFVSSPSE ISSAAAVPIQ DDPNVRSIAP LVHQGINSYL  120
PEATSAAPYT GKMYRTAPMQ RVASLEHLQK RICTGTNSFG SIHWDTVNFC NQNQI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274216.15e-52PREDICTED: light-inducible protein CPRF2 isoform X1
RefseqXP_010274217.15e-52PREDICTED: light-inducible protein CPRF2 isoform X2
SwissprotQ990904e-38CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLQ8RU622e-49Q8RU62_ORYSA; BZIP protein (Fragment)
TrEMBLC4JB674e-49C4JB67_MAIZE; Uncharacterized protein
TrEMBLC5WX706e-49C5WX70_SORBI; Putative uncharacterized protein Sb01g005170
STRINGSb01g005170.12e-48(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34883878
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.12e-36bZIP family protein