PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_02641
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 188aa    MW: 20459.5 Da    PI: 7.4075
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_02641genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-43221211100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C++dC++apyfpa++p+kfa vhk+FGasnv+kll++l+  +r+da+sslvyeA+ar+rdPvyG+v+ i++lq+q++ l+a+lal+++
  PEQU_02641  22 PCAACKLLRRRCVQDCIFAPYFPADEPQKFATVHKVFGASNVSKLLQELSVVQRSDAVSSLVYEANARVRDPVYGCVASISSLQRQINLLHAQLALAQA 120
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  PEQU_02641 121 E 121
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1921122IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-4322119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MEREAKEMAN RKQGSSGAAV SPCAACKLLR RRCVQDCIFA PYFPADEPQK FATVHKVFGA  60
SNVSKLLQEL SVVQRSDAVS SLVYEANARV RDPVYGCVAS ISSLQRQINL LHAQLALAQA  120
EIVHLHLQHA ALFACSSTVA MTPLCNDATA STNTSQSVIE NANINEKTLF SIEMLLDHPN  180
IGLPMWSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-47151234112LOB family transfactor Ramosa2.1
5ly0_B4e-47151234112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020586032.11e-138LOB domain-containing protein 4
SwissprotQ9SHE93e-59LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A2I0WQB21e-125A0A2I0WQB2_9ASPA; LOB domain-containing protein 4
STRINGGorai.011G051200.13e-71(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-60LOB domain-containing protein 4