PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_00874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 109aa    MW: 12498.2 Da    PI: 10.1909
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_00874genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.12.4e-302583159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                ldDgy+WrKYG+K+vk+s++pr+YYrCts gC+vkk++er +ed ++v +tYeg H h+
  PEQU_00874 25 LDDGYKWRKYGRKKVKDSPNPRNYYRCTSGGCNVKKRIERMREDSSYVLTTYEGIHSHH 83
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-301385IPR003657WRKY domain
SuperFamilySSF1182904.05E-271885IPR003657WRKY domain
PROSITE profilePS5081130.4352085IPR003657WRKY domain
SMARTSM007743.3E-312584IPR003657WRKY domain
PfamPF031061.0E-222683IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
SFMCRGRKEK IGRIAFITKS DIDKLDDGYK WRKYGRKKVK DSPNPRNYYR CTSGGCNVKK  60
RIERMREDSS YVLTTYEGIH SHHAPYTETT QPGAMAASSV MAALNGLNW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-241285477Probable WRKY transcription factor 4
2lex_A4e-241285477Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020591632.18e-59probable WRKY transcription factor 75
SwissprotO229001e-30WRK23_ARATH; WRKY transcription factor 23
SwissprotQ8VWQ54e-31WRK50_ARATH; Probable WRKY transcription factor 50
SwissprotQ93WV47e-31WRK71_ARATH; WRKY transcription factor 71
SwissprotQ9FGZ41e-30WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLA0A3Q0HNJ92e-38A0A3Q0HNJ9_PHODC; probable WRKY transcription factor 75 isoform X1
STRINGGorai.007G245200.15e-37(Gossypium raimondii)
STRINGGorai.011G114200.14e-37(Gossypium raimondii)
STRINGcassava4.1_016594m6e-37(Manihot esculenta)
STRINGXP_010261070.17e-37(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-33WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  5. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  6. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  7. Yu Y, et al.
    WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana.
    Plant Cell Physiol., 2018. 59(2): p. 414-422
    [PMID:29272465]
  8. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]