PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_00789
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CO-like
Protein Properties Length: 358aa    MW: 39882.9 Da    PI: 6.0115
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_00789genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.8e-07949438
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                  C+ ++++++  fC+ ++  lC  C  e H        H+
  PEQU_00789  9 VLCDSCDSECAVVFCRADSARLCLACDREVHAAntvssrHN 49
                57*****************************6655666666 PP

2CCT58.72.1e-20309353145
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                 R   +lRYkeKrktR+++K +rYesRKa+A+sR R+KGrF+k+++
  PEQU_00789 309 RSSVILRYKEKRKTRRYDKLVRYESRKARADSRVRIKGRFAKANQ 353
                 67789*************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.566653IPR000315B-box-type zinc finger
SMARTSM003362.9E-11653IPR000315B-box-type zinc finger
CDDcd000212.90E-6953No hitNo description
PROSITE profilePS5101714.684309351IPR010402CCT domain
PfamPF062032.2E-15309351IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MVSADADSVL CDSCDSECAV VFCRADSARL CLACDREVHA ANTVSSRHNR SLLCDSCASA  60
PATIFCPTSP HRLVLCSSCD FNAHQVDDHR HDRRAVDPFT GCPAGAVLAA ALGIGDDKAT  120
LPNKVEEDWA WEVPLVFSWD DLLLQPTTTS FHGFQAMGIP PPQKDLIQPC NYSDHLGLPI  180
RQDKNTSCGK REEEIHRQFR KLIVNEADGF DCSEENVPVK ESKSLLQENP QLGKLDNEYG  240
YLPVFVEVPS CEISKVQCNL TDDQMAVRNP VEVSQEKQIG SSSSAETFAD RTIEAASHPC  300
LPKDELFDRS SVILRYKEKR KTRRYDKLVR YESRKARADS RVRIKGRFAK ANQVPNPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM9QXJ90.0M9QXJ9_9ASPA; CONSTANS-like 10
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37592222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.15e-52B-box type zinc finger protein with CCT domain