PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s976271g003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Dof
Protein Properties Length: 286aa    MW: 30551 Da    PI: 7.7495
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s976271g003genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.91.4e-402788263
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                       +++alkcprCdstntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  PDK_30s976271g003 27 PDQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKGCRRYWTQGGSLRNVPVGGGCRKNKRSSS 88
                       6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-282585IPR003851Zinc finger, Dof-type
PfamPF027014.9E-342885IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5623185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MASHPLEEVL VCSKPQQPGE RKQRPHPDQA LKCPRCDSTN TKFCYYNNYS LSQPRYFCKG  60
CRRYWTQGGS LRNVPVGGGC RKNKRSSSSS SSSSSSSKRL IADQDPTSNS NPLLPGLIPP  120
PLSYDPSDLT LAFAGLHKPP TPKQLGLEDH DTFLLGNPNP NPNPSTSSIP TAPASGFLDI  180
LRSGFADTTS PNGFHNLYYG FGGNGNVEGG VSGEEMLLPF EGGFGGAPTT TSQGSCKAMD  240
GGENKVLMGL QWPLSGDHGN LVMDSGRDIW NGVGSSWHGL INSSLM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783672.10.0dof zinc finger protein DOF2.1
TrEMBLA0A2H3XHE30.0A0A2H3XHE3_PHODC; dof zinc finger protein DOF2.1
STRINGXP_008783672.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.16e-38Dof family protein