PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s914091g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family WRKY
Protein Properties Length: 361aa    MW: 39304.5 Da    PI: 7.1959
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s914091g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.94.4e-33125181259
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkk+ers  d++++ i+Y+g+Hnh+
  PDK_30s914091g001 125 DDGYNWRKYGQKMVKGSEYPRSYYKCTHPNCPVKKKIERSL-DGQITGIIYKGQHNHQ 181
                        8****************************************.***************8 PP

2WRKY33.77e-11305325121
                        ---SS-EEEEEEE--TT-SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefp 21 
                        ldDgy+WrKYGqK+vkg+++p
  PDK_30s914091g001 305 LDDGYRWRKYGQKVVKGNPNP 325
                        59*****************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-29119183IPR003657WRKY domain
SuperFamilySSF1182903.14E-26122183IPR003657WRKY domain
SMARTSM007741.2E-35124182IPR003657WRKY domain
PfamPF031065.3E-25125181IPR003657WRKY domain
PROSITE profilePS5081123.72125183IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-12290325IPR003657WRKY domain
SuperFamilySSF1182908.11E-9297325IPR003657WRKY domain
PROSITE profilePS5081115.021300325IPR003657WRKY domain
SMARTSM007743.5E-5305342IPR003657WRKY domain
PfamPF031061.8E-6306325IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MTRPPQIFTV PPGLSPTGLL GSSPLFSPGL GNFGMSHQQV LAQVTAQAAQ SQVKMLSEAE  60
CSSSLSVATA TSLAQNTSSA IHTTPTQEMS TLTSNTDNST FESAEGSHYD QRSQPTALIV  120
DKPADDGYNW RKYGQKMVKG SEYPRSYYKC THPNCPVKKK IERSLDGQIT GIIYKGQHNH  180
QHPQPNKRAK EVGTLPSGSN EFNGNPGIPT NSEPGSQAYP RNFSRSDETM AAPSASKRDQ  240
ESSYGTPEQL SGASDGEEAG DVELRTDEGG DNEPDPKRRN ILTSSQRTVT EPRIIVQTTS  300
EVDLLDDGYR WRKYGQKVVK GNPNPSMQEA PILDSTRIYI LRAIAVLFLV PSRTLNRGVT  360
T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-181251831877Probable WRKY transcription factor 4
2lex_A2e-181251831877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008787092.10.0PREDICTED: probable WRKY transcription factor 4
RefseqXP_008787093.10.0PREDICTED: probable WRKY transcription factor 4
RefseqXP_008787094.10.0PREDICTED: probable WRKY transcription factor 4
RefseqXP_008787095.10.0PREDICTED: probable WRKY transcription factor 4
RefseqXP_008787096.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ701e-100WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLM0TKY11e-130M0TKY1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P26450_0011e-129(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.16e-79WRKY DNA-binding protein 3