PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s887211g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family bZIP
Protein Properties Length: 420aa    MW: 45390.4 Da    PI: 6.5163
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s887211g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-10233291563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+   + l++e+
  PDK_30s887211g001 233 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTMLQRDTSGLTAEN 291
                        9***********************************************99988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-16229293IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921231294IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.54E-11233284No hitNo description
PfamPF001705.2E-9233290IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.9E-11233287No hitNo description
CDDcd147039.62E-24234283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MEKDKSPVHG GGGGCAAAGG GSGLPPPLPR YAALASPSSS FPLKGEPSSS SSIPGSTPES  60
GHFGQRVVPD TGQFSHDISG MPEHPPRNVG HRRAQSEILS LPDDISFDSD LGVVGSGEGP  120
SLSDETEEDL LSMYLDMDKF TSSSAASELD LLGSENSVTA AAPAPTFPLQ TENLASASNE  180
RPRVRHQHSQ SMDGSTSIKP EILASGSERP SLAETKKAMS AAKLADISLV DPKRAKRIWA  240
NRQSAARSKE RKMRYIAELE RKVQTLQTEA TTLSAQLTML QRDTSGLTAE NNELKLRLQT  300
MEQQVHLQDA LNDALREEVQ RLKIATGPAN PNGGQVMNLG PSFGATQQYY HRSHAMQSLM  360
AARQLQQLQI HSQHQQQMHP QQHQPQVQQQ QQQQSPADLK MKGVMTSQRE GTSDNSTPQE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6066273e-31AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
GenBankAP0149603e-31AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCR8551963e-31CR855196.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0159F11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008791799.10.0transcription factor RF2a-like isoform X1
SwissprotQ040881e-127POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A2H3Y1700.0A0A2H3Y170_PHODC; transcription factor RF2a-like isoform X1
STRINGXP_008791799.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-135bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]