PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s854671g005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family LFY
Protein Properties Length: 272aa    MW: 30889.8 Da    PI: 8.2774
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s854671g005genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY375.11.1e-11427243148368
            FLO_LFY 148 glseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepg 239
                        glseepvq+e+eaa+s ge ++    +aa++  + +++++++k+k+k+k+++e++ ee+ed   + +e +egs ++  erqrehPfivtepg
  PDK_30s854671g005  27 GLSEEPVQQEREAAASVGEAAA----AAANNDGRAKQRRSTTKSKAKKKRSSEEEGEEEEDGWGTGSEGSEGSERSVVERQREHPFIVTEPG 114
                        89**********9999777732....2233233344555555667888888887777888888888888888888899************** PP

            FLO_LFY 240 evargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkerge 331
                        evar+kknGLDYLf+LyeqCr+fLlqvq++ak+rG+kcPtkvtnqvfryakkagas inkPkmrhYvhCYalhcLdeeasnalrra+kerge
  PDK_30s854671g005 115 EVARAKKNGLDYLFHLYEQCRHFLLQVQSLAKDRGDKCPTKVTNQVFRYAKKAGASCINKPKMRHYVHCYALHCLDEEASNALRRAYKERGE 206
                        ******************************************************************************************** PP

            FLO_LFY 332 nvGawrqacykplvaiaarqgwdidavfnahprLsiW 368
                        nvGawrqacykplvai+ar+gwdidavfnahprLsi 
  PDK_30s854671g005 207 NVGAWRQACYKPLVAISARHGWDIDAVFNAHPRLSIC 243
                        ***********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016986.0E-11927243IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MDMERYLIPI VFDFGFSDIS NFWPPTGLSE EPVQQEREAA ASVGEAAAAA ANNDGRAKQR  60
RSTTKSKAKK KRSSEEEGEE EEDGWGTGSE GSEGSERSVV ERQREHPFIV TEPGEVARAK  120
KNGLDYLFHL YEQCRHFLLQ VQSLAKDRGD KCPTKVTNQV FRYAKKAGAS CINKPKMRHY  180
VHCYALHCLD EEASNALRRA YKERGENVGA WRQACYKPLV AISARHGWDI DAVFNAHPRL  240
SICVLLLRQD WSFQRQIERQ PGLKNYIVIS IV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A5e-961002423145PROTEIN LEAFY
2vy2_A5e-961002423145PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor that act to specify determinacy in the progenitor cells for both flowers and leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008797158.11e-155floricaula/leafy homolog
SwissprotO040641e-100FLLH_POPTR; Floricaula/leafy homolog
SwissprotQ405041e-100FL1_TOBAC; Floricaula/leafy homolog 1
TrEMBLA0A2H3YDG51e-154A0A2H3YDG5_PHODC; floricaula/leafy homolog
STRINGXP_008797158.11e-154(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-91floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]