PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s844721g010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family G2-like
Protein Properties Length: 293aa    MW: 32371.4 Da    PI: 7.7906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s844721g010genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-29226277253
            G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                        pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ +
  PDK_30s844721g010 226 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQVF 277
                        9*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-14223278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-25224277IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-22226277IPR006447Myb domain, plants
PfamPF002499.0E-6227275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MQTQGVFTET TSIPSPDLSL HIRPPRTTPS STADTHHDLS LDLLQRIEAL KPQADSCSNF  60
ACTDLTLSSP LATSEVDGPW RWEGALQDRC HNSHLSDLVL DDRRPIKGIP IYNSNTSPFL  120
SADPTMGFNH QMSSTPSLWS SFCSSVPSSP SSSSGYSSNL DTAASFLHPV MAPPTRFAGL  180
SSDTINYNHH PHHHHQYGIG PLDVSHNMMR SRFMQKLSAK RSMRAPRMRW TSTLHARFVH  240
AVELLGGHER ATPKSVLELM DVKDLTLAHV KSHLQVFSFL CLRPHSSSSS PST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-15227277454Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798307.11e-177probable transcription factor RL9 isoform X3
TrEMBLA0A2H3YG991e-176A0A2H3YG99_PHODC; probable transcription factor RL9 isoform X3
STRINGXP_008798291.11e-176(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-36G2-like family protein