PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s830191g005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Trihelix
Protein Properties Length: 242aa    MW: 28909.1 Da    PI: 6.8063
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s830191g005genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix83.92e-261192186
           trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                       +W++qe+++Li +r ++e++l  ++ +k+lWe+v+++mrerg++r+p qCk+kw+nl +ryk +++ + ++     ++cp+f++l+
  PDK_30s830191g005 11 QWSEQETRELIGFRGDLERDLTVARWNKTLWEAVAARMRERGYRRTPDQCKCKWKNLVNRYKDTETADPEN----GRQCPFFEELH 92
                       7***************************************************************9999974....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.153468IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.8E-4570IPR009057Homeodomain-like
PfamPF138371.3E-231093No hitNo description
CDDcd122038.21E-201175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGKEERVAQV QWSEQETREL IGFRGDLERD LTVARWNKTL WEAVAARMRE RGYRRTPDQC  60
KCKWKNLVNR YKDTETADPE NGRQCPFFEE LHAVFMERAR NMQRLLLESE SSASPSKKKL  120
KRLGADRSSG EFSEDDDEDD EDSDGEHPSK SRKKKADKGA QQQQQRTKAS SSIHELLQEF  180
LQQQQRVEVQ WREVMERRAQ ERRAFEQEWR QEEQRRMREE SRAEKRDALL TTLLNKLIQD  240
DF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A5e-141282777DNA binding protein GT-1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008803970.11e-139PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A0L9URU24e-94A0A0L9URU2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3G04e-94A0A0S3T3G0_PHAAN; Uncharacterized protein
STRINGGSMUA_Achr7P04840_0017e-92(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106883037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.17e-26Trihelix family protein