PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s825821g010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family CPP
Protein Properties Length: 277aa    MW: 30448.9 Da    PI: 9.0702
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s825821g010genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR52.78.6e-173372140
                TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                       k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC dCkN e
  PDK_30s825821g010 33 KHNKGCHCKKSGCLKKYCECFQANILCSDNCKCMDCKNYE 72
                       589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163419.71173IPR005172CRC domain
SMARTSM011143.7E-203374IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-133671IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MVCRTGPYRL VRAGTYRSGL GPEETGDLPL VGKHNKGCHC KKSGCLKKYC ECFQANILCS  60
DNCKCMDCKN YEGSEERRAL FNSDMGNSHS FIQQAANAAL NGAIGSSGFG SPPAFKKRKS  120
QEPLLPPTVK DQSVLRHGQF PQANHMKTAG PASSFTSSSV AHAINPNLLG SSKVTYRSPL  180
ADIVQPEDVK ELCKFLVVVS SEVARTFADG PCLKSIWPTN ISLQYGRAIH LPHDAIDSYA  240
KISKILPSIW SLSYHHRLLA ATCLRDWIWL VQPLRQQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783312.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD19e-69TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A067DUG96e-78A0A067DUG9_CITSI; Uncharacterized protein
TrEMBLM0TXZ29e-79M0TXZ2_MUSAM; Uncharacterized protein
TrEMBLV4UJK85e-78V4UJK8_9R
STRINGGSMUA_Achr9P06330_0013e-78(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47303657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.15e-70Tesmin/TSO1-like CXC domain-containing protein