PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s814491g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family G2-like
Protein Properties Length: 392aa    MW: 42719.6 Da    PI: 6.9307
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s814491g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.2e-32227280255
            G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  PDK_30s814491g001 227 PRMRWTSTLHARFVHAVEFLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 280
                        9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15224281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28225281IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-24227280IPR006447Myb domain, plants
PfamPF002493.8E-6228279IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MPSLDLSLNI SLPSPTPSST PDTDGDLSLD LLHQIEALKP QAEGCSNLLA CTHLSLSSSL  60
ATSEADGSWR WQGPLHDRCQ SSHLELVFDG SKPIKGIPIY NSSSTPFPSA DPEMGFNHQM  120
ISSPSSWPLF CSSVPSSPSS SCGYSTNLDT MTSFLHPAGL VPSMASSYHR IVAPPTRFTG  180
LSSDTIKYNQ HYNHHQQHGI GPLDVSQNMM RSRFMQKIPV KRSVRAPRMR WTSTLHARFV  240
HAVEFLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKSTDKPAAS SEGSGEEDSA  300
LGTGNLSFRR LMEHKGSDGP IQLNDIDSNT RWSNSSSTGA WTQTNSSEME GLRPATFTSQ  360
TEGSHPCRTS GSTGSHQELK SPSLEFTLGR PD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-17228282458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017697926.10.0probable transcription factor RL9
SwissprotQ0J2355e-57ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A2H3ZP570.0A0A2H3ZP57_PHODC; probable transcription factor RL9
STRINGXP_008798291.11e-178(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-47G2-like family protein