PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s803301g004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family G2-like
Protein Properties Length: 504aa    MW: 55695.3 Da    PI: 6.7487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s803301g004genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.77.3e-35249303155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        kpr+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  PDK_30s803301g004 249 KPRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVEGLTIYHVKSHLQKYRT 303
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-18246303IPR009057Homeodomain-like
PROSITE profilePS5129411.87246306IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-33247305IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-25249303IPR006447Myb domain, plants
PfamPF002496.1E-10251302IPR001005SANT/Myb domain
PfamPF143798.0E-7335355IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143795.3E-11395420IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
METQRVKNFN VKHFRSTGNS EVMSSSLPVL PAPFEEKFPK LPDSQQLSVE RELRSSPIIP  60
HHTPFVSNSG VVGPLYSSAS GFSSDLHFSS VSPNVRHPNG SSFVSRSSNV GISFPSTPSH  120
SGAFQSSTVN HPRESTKVTW CPEPIQSMID YSDNITDGNN EIQNSCDVVS DDFAKQNEWW  180
TDLMNEDWKD ILNETSATVS QPKAMQSAAQ ASPSISAHQP QIHQVVPSQS GEICTVSNSS  240
SAANATTTKP RMRWTPELHE CFVDAVNQLG GSEKATPKGV LKLMKVEGLT IYHVKSHLQK  300
YRTARYRPDS SEGASEKMVT PQQEVSSLDL KTSINLTEAL QLQMEVQKQL HEQLEQYGGK  360
VPPPRGLPLY MYSMWIIALK NARKVFCPKP LLDVVQRNLQ LRIEEQGRYL QMMFEKQCKS  420
GIDKLQAPST KEEPSTVSSD QTYSADKELP GKVRGESGND PAGTEIAEGS RQVGDKQKMP  480
EAESCNERES NTVSGSHSPP CKRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-31249307260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008801249.10.0protein PHOSPHATE STARVATION RESPONSE 2-like
RefseqXP_026663617.10.0protein PHOSPHATE STARVATION RESPONSE 2-like
TrEMBLA0A2H3YN120.0A0A2H3YN12_PHODC; protein PHOSPHATE STARVATION RESPONSE 2-like
STRINGXP_008801249.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.18e-78phosphate starvation response 1