PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s795141g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family LFY
Protein Properties Length: 446aa    MW: 50287.3 Da    PI: 11.2046
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s795141g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY5408.2e-16514241386
            FLO_LFY   1 mdp.eafsaslfkwdpraaa.....aapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeel 86 
                        mdp +afsa++fkwdp a       +++pa ++   + +++p ++    ++ + rel e+f++yGvry+tva+++elGft+stLv+m++ e+
  PDK_30s795141g001   1 MDPgDAFSANIFKWDPPAPPpcrsmEPTPAAAAAGGEGEPQPRQERRGGEEGQPRELGEVFSGYGVRYATVARLGELGFTASTLVGMTEGEV 92 
                        666367*********5432223332223333333333444445555666666689************************************* PP

            FLO_LFY  87 ddlmkslseifrldllvGeryGikaavraerrrlee....................eeaekkrrkll..........sedeetaldalsqeg 148
                        ++++++l+++fr+dll+GeryGikaa+raerrrl +                    + ++++rr ll              ++aldalsqe+
  PDK_30s795141g001  93 EEVLSALAHLFRWDLLLGERYGIKAALRAERRRLLDhhqamlflrhehhhqpaagvD-EDARRRMLLlnspghlhhnLGGLNHALDALSQEA 183
                        **********************************999******************54.45555554447776543222223459*******8 PP

            FLO_LFY 149 ..lseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeede.deegsgedgeerqrehPfivte 237
                          + +e  q+ + +  s +++  +a+   ++++   ++    ++ k +r+  ++++ ++d+++++++ +  +++ + +ge     hPfivte
  PDK_30s795141g001 184 tmMMDEVGQDCRRSRCSRRGRRRRAAGRRTTTTAGPSSGGAPRNPKPRRRAGRRTRRRRDHHRRRRRRRrRRRRRRMGGELGGGGHPFIVTE 275
                        6445666666666666644443333333333233333333333335555555554555555555544440445556666667889******* PP

            FLO_LFY 238 pgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafker 329
                        pgevar+kknGLDYLf+LyeqCr+fLlqvq++akerG+kcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+ker
  PDK_30s795141g001 276 PGEVARAKKNGLDYLFHLYEQCRHFLLQVQSLAKERGDKCPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKER 367
                        ******************************************************************************************** PP

            FLO_LFY 330 genvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                        genvGawrqacykplvai+ar+gwdidavfnahprLsiWYvPtkLrqLChl+rs+a+
  PDK_30s795141g001 368 GENVGAWRQACYKPLVAISARHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLARSNAA 424
                        ******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.9E-1651424IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MDPGDAFSAN IFKWDPPAPP PCRSMEPTPA AAAAGGEGEP QPRQERRGGE EGQPRELGEV  60
FSGYGVRYAT VARLGELGFT ASTLVGMTEG EVEEVLSALA HLFRWDLLLG ERYGIKAALR  120
AERRRLLDHH QAMLFLRHEH HHQPAAGVDE DARRRMLLLN SPGHLHHNLG GLNHALDALS  180
QEATMMMDEV GQDCRRSRCS RRGRRRRAAG RRTTTTAGPS SGGAPRNPKP RRRAGRRTRR  240
RRDHHRRRRR RRRRRRRRRM GGELGGGGHP FIVTEPGEVA RAKKNGLDYL FHLYEQCRHF  300
LLQVQSLAKE RGDKCPTKVT NQVFRYAKKV GASYINKPKM RHYVHCYALH CLDEEASNAL  360
RRAYKERGEN VGAWRQACYK PLVAISARHG WDIDAVFNAH PRLSIWYVPT KLRQLCHLAR  420
SNAAAASTSV LGATSSDGLP PPPPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1062694389178PROTEIN LEAFY
2vy2_A1e-1062694389178PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235242RRTRRRRD
2239258RRRDHHRRRRRRRRRRRRRR
3241253RDHHRRRRRRRRR
4245258RRRRRRRRRRRRRR
5246259RRRRRRRRRRRRRM
6248258RRRRRRRRRRR
7250258RRRRRRRRR
8251258RRRRRRRR
9252258RRRRRRR
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008775161.10.0floricaula/leafy homolog
SwissprotO485591e-138UNI_PEA; Protein UNIFOLIATA
TrEMBLA0A2H3WXH30.0A0A2H3WXH3_PHODC; floricaula/leafy homolog
STRINGXP_008775161.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-105floral meristem identity control protein LEAFY (LFY)