PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s785291g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family M-type_MADS
Protein Properties Length: 389aa    MW: 43791.6 Da    PI: 6.3505
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s785291g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.53.1e-221053245
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                       + en+s rqvt+skRr+gilKKA+ELS+LCd++  +++fs+tgk
  PDK_30s785291g001 10 KLENSSGRQVTYSKRRAGILKKAKELSILCDIDLILLMFSPTGK 53
                       679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.614153IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-17323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRQVT YSKRRAGILK KAKELSILCD IDLILLMFSP TGKPTLCVGD  60
RSTIEEVVAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFMGSS SQTVEVLITN  120
ITFTNSTFYS IRIAFSLFVY TVLIESLVQD LTNHLRSLQA QLSDVQKRLS YWTDPDKIND  180
IDHIRAMEQS LRESLSRIQV HKENLGKQLV SLDCSSQFQN DIHLPLGLGG EHGPSPVAWL  240
HSNDGQQMML PEDPHLLPQR DIGCSTDTSI QSYSGYFNTG KQAEATEQLQ EDSLHEFSQN  300
ACLRLQLGGQ YPYQPYCQNL IGENTFKPDA ENSLPESTID YQVNHSEPPR PGYDASFQNW  360
ASTSGTCGVT IYDAQSYSRV SVLFLSMLV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029118787.10.0agamous-like MADS-box protein AGL65 isoform X3
SwissprotQ7X9I04e-87AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A2H3YDL40.0A0A2H3YDL4_PHODC; agamous-like MADS-box protein AGL65 isoform X1
STRINGXP_008797164.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-74AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]