PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s769401g007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRAS
Protein Properties Length: 649aa    MW: 72627.5 Da    PI: 5.9141
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s769401g007genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.93.9e-1312686342373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        v+lL++cAe v+sg++e+++ +Larl el+sp+g+p++R+aayfteALa r+++ +++++++ pp+   +++ ++ + al+l+++vsPi+kf
  PDK_30s769401g007 268 VSLLTSCAESVNSGNHEAVTFFLARLGELSSPTGTPIRRVAAYFTEALALRVVKLWPHIFSITPPRVLVDQTDDDDAVALQLLNQVSPIPKF 359
                        789***************************************************************************************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                         h+t N+ +l+a+eg++rvHiiDfdi+qGlQWp L+q+LasRp++p ++RiTg+g+    s++ l+etg rLa+fAe++++pfef++ v++r
  PDK_30s769401g007 360 LHFTVNERVLRAFEGKDRVHIIDFDIKQGLQWPGLFQSLASRPDPPSHVRITGIGE----SRQDLQETGARLARFAEAFNLPFEFHA-VVDR 446
                        ********************************************************....9**************************.7*** PP

               GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                        led++l++L+vk++E++aVn++l +h+ l +++  +    ++L l++s++P +v ++eqea+hn++++ +r++++l+yysa+fdsl+ +lp+
  PDK_30s769401g007 447 LEDVRLWMLHVKREECVAVNCILVMHKALYDETGGAL--MNLLGLIRSTNPAIVLIAEQEAQHNDPRWETRLANSLQYYSAIFDSLDYSLPE 536
                        ***************************9966554444..78*************************************************** PP

               GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee...sgslvlgWkdrp 366
                        +s +rik+E++ ++rei+n+vaceg+er+ rhe++e+Wr+ + + GF+ + ++e+++ q +lllr ++++ y++ ++   ++ l+l W +rp
  PDK_30s769401g007 537 DSPARIKIEEM-FAREIRNLVACEGSERVDRHEKFERWRNLMVDRGFRCMGIGEREMLQSRLLLRVYDGENYSIVKQgegNDGLTLNWLNRP 627
                        ***********.********************************************************999**996655599********** PP

               GRAS 367 LvsvSaW 373
                        L++vSaW
  PDK_30s769401g007 628 LFTVSAW 634
                        ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.929241612IPR005202Transcription factor GRAS
PfamPF035141.3E-128268634IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MLAGCSSALL SPRHRLRSDA SVQLQGSHFQ LQEKLYPSKQ RMSTQRIDLP CSFSRKDAPR  60
VALSLEKPAE TRSSSCSFRP NPVTPSSSSV AAQAVSWEGR IEITEGGLWE RRRSSKRFHE  120
RSLSEEDSCL DRAKRTRTGD ATQFAGGEDD IWFPQSTKEH PLVEEGEEEK VFLVPNAALF  180
PFYTSSSSTL VGSFETEKDL VTSVQPNYKS QSDSSSSSDT HSSSPKQQKD SSENVARNGS  240
QIPYSTRSAG IAGQGENPQT EQQGIEIVSL LTSCAESVNS GNHEAVTFFL ARLGELSSPT  300
GTPIRRVAAY FTEALALRVV KLWPHIFSIT PPRVLVDQTD DDDAVALQLL NQVSPIPKFL  360
HFTVNERVLR AFEGKDRVHI IDFDIKQGLQ WPGLFQSLAS RPDPPSHVRI TGIGESRQDL  420
QETGARLARF AEAFNLPFEF HAVVDRLEDV RLWMLHVKRE ECVAVNCILV MHKALYDETG  480
GALMNLLGLI RSTNPAIVLI AEQEAQHNDP RWETRLANSL QYYSAIFDSL DYSLPEDSPA  540
RIKIEEMFAR EIRNLVACEG SERVDRHEKF ERWRNLMVDR GFRCMGIGER EMLQSRLLLR  600
VYDGENYSIV KQGEGNDGLT LNWLNRPLFT VSAWAPIDIA GSSSAPQPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A4e-7925963610379Protein SCARECROW
5b3h_D4e-7925963610379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800814.10.0protein DWARF AND LOW-TILLERING
SwissprotQ9CAN31e-180SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A2H3YLZ40.0A0A2H3YLZ4_PHODC; protein DWARF AND LOW-TILLERING
STRINGXP_008800814.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-178GRAS family protein