PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s764531g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family bZIP
Protein Properties Length: 390aa    MW: 42636.5 Da    PI: 9.5744
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s764531g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.4e-10201258562
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                        kr++r   NR +A rs +RK  +i+eLe+kv++L++e  +L  +l   +     l++e
  PDK_30s764531g001 201 KRAKRIWANRQSAARSKERKTRYIAELEQKVQSLQTEAATLSARLTLVQRDTNGLTAE 258
                        9*****************************************9998877766666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-15197261IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507199262IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-8201261No hitNo description
SuperFamilySSF579596.47E-10201252No hitNo description
PfamPF001701.3E-8201250IPR004827Basic-leucine zipper domain
CDDcd147032.51E-22202251No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MDKDKAPVHG GGDGFPTHSS RFSAFAASSS KVPFMGDPSP SSSSHSNPES SRSGQLSHDI  60
SRSPDFPPRN PGHRRAYSEI LRFPDDTSFY SDLGIVGPSL SDDTDEDLLS AYLNIKKLNS  120
SSVLSGGQPS GPAAAPLSPS QTENLASGLN ERPRARHQHS WSMDGSSSVL LGSSSEGPTS  180
AEMKKAISAA KLADLALVDP KRAKRIWANR QSAARSKERK TRYIAELEQK VQSLQTEAAT  240
LSARLTLVQR DTNGLTAENS ELKLRLQTME QQVHLQDALN DALREEVQRL KLATGQLMPN  300
GGPLMNFGPP LFGSSQQFYH HNQAMQSLLA AHQFQQLPIH PQHQQQLHPL QPLQQQQLHL  360
PQPQPPADLR MKCPMTSWNK RGKGTSDNSN
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927887.10.0transcription factor RF2a
SwissprotQ040881e-118POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A3Q0I1L60.0A0A3Q0I1L6_PHODC; probable transcription factor PosF21
STRINGXP_008790677.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-100bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]