PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s728141g003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family G2-like
Protein Properties Length: 717aa    MW: 80565.7 Da    PI: 6.5735
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s728141g003genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.92.6e-34469523155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        k+r+rWtpeLHe+Fveav++LGGsekAtPk +l+lm+v+gLt++hvkSHLQkYR+
  PDK_30s728141g003 469 KQRMRWTPELHECFVEAVNKLGGSEKATPKGVLKLMNVEGLTIYHVKSHLQKYRT 523
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037672.4E-4143205IPR005519Acid phosphatase, class B-like
SuperFamilySSF567841.48E-18103208IPR023214HAD-like domain
Gene3DG3DSA:3.40.50.10002.3E-15104194IPR023214HAD-like domain
PROSITE profilePS5129413.551466526IPR017930Myb domain
SuperFamilySSF466893.58E-18467523IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-32468525IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-26469523IPR006447Myb domain, plants
PfamPF002491.6E-10471522IPR001005SANT/Myb domain
PfamPF143794.7E-9554575IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143791.1E-8593618IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MEKRRAETLL LFFIFSIAVV AGDWNILSYM AKKRDHHQVG ISLKNYCESW RMNAELNNIR  60
CFDVVPGECV GYIGKYMTST QYKVDVQRAA EEATLFLTNS FLLGGDGKDA WVFDIDDTLL  120
STVPYFKKHQ FGGATTNRTS MEQWMEERSA PAVEHMLNLY HQIRARGLKV FLISSRREHL  180
RDATIDNLVK VGYLGWAELI LRCKRHYKLD IDLGLGQEHR GSIALVDCAQ LLKRVPLQLS  240
HLSLEENIFK MFCASDAKVT MERELRSDPM APLHTPYVKN NGVAEPFFST ASGFSLDVHC  300
TSVPPYERQP VSASYISQPS SSALSLSSTY SSYSGTCQPS MSNYPKESAE ITWYSDSLQG  360
VLDYSDNVNT VNDQIQSNCV MTSDNLIKQN EWPDLTDLMN GDWGEFLDNR DATEPQPKAS  420
DLHVVYPAAQ ASTDSSAYHS QIYESVHSHS GEQCAVGSLS SSANAAPAKQ RMRWTPELHE  480
CFVEAVNKLG GSEKATPKGV LKLMNVEGLT IYHVKSHLQK YRTARYRPES SEGTSAKKIT  540
PLEEMPSLDL KTGIEITKAL RLQMEVQKRL HEQLEPLKKS EAGHHYPFLQ TIHIQRKLQL  600
QIEEQGKYLQ MMFEKQGKAG SDKLKAPSNE EDPSSQYSDL SHNVTKDGIS EKDRAETENG  660
PSGASILEEC SRQVGDKQKI VEPDADMRSN TIRSHSSPHK RARSHDADVS SATSAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-30468527160Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008796363.10.0protein PHOSPHATE STARVATION RESPONSE 2-like isoform X1
RefseqXP_026662295.10.0protein PHOSPHATE STARVATION RESPONSE 2-like isoform X1
TrEMBLA0A2H3YBR00.0A0A2H3YBR0_PHODC; protein PHOSPHATE STARVATION RESPONSE 2-like isoform X1
STRINGXP_008796363.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.23e-69G2-like family protein